ELF44 (444[[[4 ? z   /lib/ld-linux.so.2GNUCR =Q1A@,8"3GMB#0CKO-?P;>I:*%$7/HFNLD 5')  &.2+96 4!(E<J !, fN6W@ЏcK Tn^ ."{.l 0-@yPF`pP"gBАp '"D   D J0Dt@3P@`Rp/!IiR Б+KT  z  20t@qP`"p 0l "@[`В.m-M . `* S $ Px0@-'P? F`@ p: q__gmon_start__libpcap.so.0.6.2pcap_closepcap_filepcap_dumppcap_stats_DYNAMICpcap_looppcap_datalinkpcap_compilepcap_open_livepcap_open_offlinepcap_next_etherentpcap_lookupdevpcap_strerroreproto_dbpcap_lookupnetbpf_imagepcap_dump_openpcap_snapshotbpf_dumppcap_setfilterpcap_geterr_GLOBAL_OFFSET_TABLE_libnsl.so.1_IO_stdin_usedlibc.so.6longjmpstrcpygetserventprintfstdout__ctype_bsetlinebuf__strtol_internalfgetsmemcpyputs__cxa_finalizegetuidmallocoptarggethostbyaddropterrfflushalarmstrrchrcallocfprintf__deregister_frame_infooptindreadstrncmpstrncpystrcasecmpsigsetsscanfgetoptlocaltimetimegetrpcbynumbersprintffclosestderrerrorfputc__errno_locationexit__fxstatfopen_IO_putc_setjmpendserventgmtime__libc_start_mainopenstrchrfputssetuid__register_frame_infovfprintf_edata__bss_start_endGLIBC_2.1.3GLIBC_2.1GLIBC_2.0_si eii qii { P     D H M                    $ ( , 0 4 8 < @ D H L  P !T "X #\ $` %d &h 'l (p )t *x +| , - 0 1 2 3 4 5 6 7 9 : ; < = > ? A E F G J K L N O QUQ"5 % % h% h% h% h% h % h(% h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx%$ h%( h%, h%0 h%4 h%8 h%< h%@ hp%D h`%H hP%L h@%P h0%T h %X h%\ h%` h%d h%h h%l h%p h%t h %x h(%| h0% h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h% h% h% h% h% h% h% hp% h`% hP% h@% h0% h % h% h% h% h1^PTRhЇhXQVhȔOUSP[vtЋ]ÉUuItt&B ut h ]ÍvU]ÍUth h ]Ð&U]ÍU ɋUt;PtuRhlUWVSDj/DžDžDžDžDž} 7N]t@% VJyVh UF2@$jj j5 /5 hv%%%   5 %%%y%m \jj j5 K;5 hќ% h5 u%vh5 u%vh5 u%vh5 iu%fh5 Au%>5 h% v%vVhWS~ ,%tqA$YXZSU uSh v5%DžDž hu* SuSh %V1hP5 uVh\ Pá9}RSPhVPPyVh$t v  P 5PS5  y 5 _ZPhx%tPS$V5%ZYhTj_XhTjY^hTjXZS5 y 5 3^_PhtB5 6u 5 ZYPh v 5 J$1ۃu+5%h.5 U_5 YSV5 y4 5 ^P5%hC5 $x 5 :$^U  P u~ 5 XZ5 j \ZYEP5 +y 5  PhV"vPuh5 T uhf5 > jUWVS E 1KuEx6Gu hQFPRhFKyEt.u hE Ee[^_]e[^_]UWVS UE Ete[^_]J]1Kx;Gu hEffPh\*KyEt)u hPhe[^_]ÍvU h h5 ZYh5 YXh@5 XZh5 $vUWVS ]C;%u }vEe[^_]Rw# h>u ]e[^_]fSffffEfsfftfuf{t+APEPAPPPh@2fu h%Eƃ t[v CP^_PhȞ_ {8t CPZYPhמ) CP~^_Ph u{83 CPY[Phמ CP(_ZPhݞu{8t CPYY^Phמ CP=_ZPh֟d{u8 CP[^PhמIv CP PQCP_ZPh" CP` PVCPZYPh$Ph} ]e[^_])f}tEPhe[^_]UWVS E }EGWtM}wEE Ee[^_]EӃ CP9 PGPj ^ZPhC$ PPj ZYPhvm^XCPGPjCPuWRQ} wEE Ee[^_]fsf C P PC PVc ZYPhrC $j PCPfCfP0 ZYPhv?m XYC PC PVC PuWR!v uGPPGPh e[^_]ÍvUS]hf;!f{f{ Stt tCPfCfS PL PCPfCfS P+Y[Ph: CP PCPfCfS P[ZPhΟvCPfCfS P PCPfCfS PZYPh&SPAPAPCPPRu h@]ÐUWVS U}M u]Et0tOMVRjhE Ee[^_]-EÉEƉEM }e[^_]4M }e[^_]UVSuF;%] v E E$e[^](%== @t=5PfFf P$uբPhiF$tSh Ht t"t' huv hev h!Uv SFPfFfPբu$Ph,( t  t# (t' hBv hv hHvfFfPhRGF$tSh &8 [tj[h_,tPhd,tPhj h%SfFfPPhpFfftPhre[^]UVS]ӍBt>1۰_ZPh%EES9iMqt! RZYPh %EES9-MAt! Rƺ^_Ph&U%EU%=upES9M5%~t 1x!ts8t$ CP譻ZYPh,%EEs,H9rUz,tY h6Y_5%Vzt/5 j"O E E]e[^_]%EES,H9Uzlt\ h?3XZ5%ClPt/5 j" E E]e[^_]M%EEH9jǁm޹8uEE ]e[^_]zflj޹8uEE ]e[^_]Ut3E EGe[^_]I E E\e[^_]e[^_]UWVS]hs%9v<SPhhpUZY@Ph~%9s69Љur5 h\}?uuEbuEEsuElEa$P5 j" juWY_5 j"1v}u5 j,}iEu EP*_ZPh Ph1҃w}}vwu5 j,PPhai1҃w;Mt2u5 j. Pha(C1҃Nuυtuh %s9e[^_]ÍvUVS ]h %SA9‰CtPhˢ %S A9C t% R Phhl %SA9Ct1 R詵 PCuӢPh& %VA9CCt% Rc Phעh %VA9 Ct% R) Phۢh %VA9Ct% R Phߢhx %VA9Ct% R赴 Phh> %V A9w_C t% R Phh %V$A9w)s$t> RI Phh E E\e[^]e[^]ÐUWVSEu EEEwEe[^_]xURUU E;uvUvEQRPh[=yY=%tSh))]];uvUvEQRPh=@t& hUu Ue[^_]t ;EvEE Ee[^_]dtnt% h`Eu Ee[^_]  EEEEG  à?@EEEE9vuRk PPS`ZYPh%tXt h'rt h,Z t h1Euh52Uu Ue[^_]UWVSL]H ߉]$ h>GEG EGWEG EGEGEGEw G  Ɖ$ VuuuuPu:^_Ph m  hDW WGWS PZYPhR.a hc WGWW P迼[^Phi% hxGW Љ$芼ZYPh^E _PEPv hGW Љ$>Y[PhqXE ZPEPv hGGEGEGECEfCfEEEE EG W EG EwG_ Ɖ$VSuu蘻$uuuh`E (PEP8v hGEGEGECEfCfEEEE EG W EG ECEfCfE]wE G $<$VSͺ Puu辺$uuuh0v h^_u S8e[^_]ÐUSR]؃t& tCvtt&4 hӣ" h h h_t hGtE]/v]ÍvUWVS } ]vbs ƁNKS  ‰ PRPQh  we[^_]ÉUWVS } ]vbs ƁNKS  ‰ PRPQh9 we[^_]ÉUSQ]؃t& tCvtt&4 hӣ" h h ht h t h&@tE]v]ÍvU]ÍvUWVS ]sC{ C ljЃ  tv_Ѓp t; t2Sv@t@08`/RVWh/SC ƒf%=uRh<RhEtSC tD%=uRh;RhD(S C U EMe[^_] hUSC ƒf%=uRh<vRhESC tD%=uRh[RhfTS C U EMe[^_](PVWhqSC ƒfҍs %=uRh<RhESC tD%=uRh[RhfS C ƒRhM\؃ Vt] Eͤe[^_],Rh؃t 2t)Ee[^_]Ee[^_]] Ee[^_]U Ee[^_]VWRhvЃp t QVWhWSC ƒf6%=uRh<vRhESC %=uU E;e[^_]U EDe[^_]RVWhSC ƒfv%=uRh<vRhEHSC $%=uU E[e[^_]U Efe[^_]u E e[^_]VWRh,vЃp00t" r@;`^pu hQ hIcPVWhSSsC ƃ{t~6tt* h` he hjt& tCvtt&4 hq" hz h hu Ee[^_]QVWhǥ{SsC ƃ{[ t~6tt* h` he hjt& tCvtt&4 hq" hz h hVh] Ee[^_]RVWhCS [$nt_] Ee[^_]QPVWhĥCCS ЉEe[^_]'vVWRhۥ VWRh e[^_]Uuhh谹PhUWVSUf jzÁu h讹VWhMSe[^_]ÐUEEUUS %BEe[^_]ÐUWVSE }ECfECfCfEC fECAQDuRGuƞPWբuPC4Ѓ4fPhF }tuhT=%~"5 h[XZWC PgWC PÃuuVh`mNfWCPNJ;%>5 j,ZYWSN;%r vCjuPG4fPhlfGtfPhtGHu,EtuhTt;Vh(tVhZ}tuhTAMtuh'Utuh WC PEE E<e[^_]UWVS ]=%9u `CP7$ h%$QVWS^ hk%PVWS hv h/ VWSv hʫv hګC C  CVW ƒSb h軿 VWSH h蟿 VWS, h胿 VWSPhfe[^_]ÍvUWVS }u}vsF F 1@~t~t ffQ衙Y[PhܾmD7;E v h 躾G9Es h蟾r119} FJuB~RÃPFPffQ ZYPh0GE)HۉEce[^_]ÍvUWVS u]} v5K9w.C C C RhFJv hAǽKvS9v h 諽/ EEPZYPhQ舽t9re[^_]ÉUWVS u]v'C;E sEECEC;CY h e EEPmZYPh_EPEPPEPLZYPhgۼ Ox vS;U rt ;] `e[^_]UWVS R%P}hu]舼8C;E EECEC3CEC EEP蕗ZYPh$EPEPPEPtZYPh t ht hӻ@t h軻 t h裻t h苻 hr{Mxv S;U }t h Lt ;] e[^_]ÍvUSR} ]U vC 9vE ] CP` PPSUZYPhCffE Eˬ]USQ}]U vC9vE ]阺 CPE$E E]kvUSS}]U vC9vE ]@ CP蘕E$荕E E]vUWVS,EH ʅ҉MxUEL%=uUE*%=u0ɉMEEEMQ A ‹]E9UUE%9E}t}w }t .}t%ECE ЉECE ЉECE E%H9C MUQMR UPB C9E|Rhȸ_X5 j(E肹M%9VPuCh!聸E( CIMx}=%w9щ%C=Uu9w} MyG9weC  ‰UC uiZYPh˰MyMC5 j)觸EE؃9EQv5 h  e[^_]ÐUWVSE ]}EC}P PQ Sْ^ZPh+h?tE Ee[^_]GvfWffGfSRPh:!WB_w$pv hG~ h4h˰x4h˰ vVhP蒶fW ffG fQRPh]54h˰Xtx!|4h˰vVhQShoGxC4h˰4hyvVhPSh{ h裵w4hy VhPzE P̐_ZPh$v hKy h54hy VhPUB PB PV PNY[Phݴ%uWv hȮ諴4hy VhP肴fW ffwf4h˰ vfPhϮ Rh2e[^_]ÍvUWVSU BEr }R2} w hpv%tr%t-VW藐 PSGP艐ZYPh]谳?v V G P菑PWV PPGPHY[Phܮo U:U=%%fC ff=f% SCPRVWE/ %um%t)VSÏ PSu趏ZYPh]ݲ; V C P运PS膏 PVuyY[Phܮ蠲 f%ft fPz^ZPhu%%uW軼vuVWP %uu%ҍFt,PSҎ PVCPĎZYPh]> P C PˏPS蒎 PVCP脎Y[Phܮ諱 %u%5%tuW5 j 8e[^_]ÐUEf%V=`Su ]Uto=` =tQ==t+=5t1=5=t?=tl~SVmvQRSVOZPRSVJ %t5 hSVvSVv1e[^]ÍvUWVSU BdB `R}jd w hh%uލ]t9M1Av B~1ҍO 2B~"vUBEfBfE܋BEfB fEE %d]؅ɣ%% EPT$J%҉t# `SVPhXV %UЁtc#AtvA @t<vOtotp t0~tdr hv h v h v h v hv hv h v`t`@tEPtPvtP tntTbPh'^Ph/NPh;>Ph<.Ph7PhEPhR语`SVh]蚭` d %E Ph<.Ph7PhEPhRO`S\h]5f%ft fP[^Ph %[ %3<@u h۪/% EP]胇$yá%t# `SVPhX膪  %Ёta!AttA @t:Ototp t0~tdr hv h v h v h v hv hv h v`t`@tEPtPvtP tntTbPh'^Ph/NPh;>Ph<.Ph7PhEPhR`SVh]Ψ%u#%udu%tdu5 j Ge[^_]UWVS EEuE EEfffxf%5 j[fy5 jCѨ@t5 jR趨 t5 jK蛨t5 jS耨5 hkt@ut tt=tE Ee[^_]N+E)EEE ue[^_]v E Ee[^_]qe[^_]UWVS8] uCP? PW S1ZYPhɷ %BA9h$A9Gte trA9@BPS老 PhP'A9FfDfB t1t\ QPS PhP车  Q蓇PS PhP艦\ QӇPS貀 Ph2PY,fAft'PSy Ph P v SS PhMPPGPhkhP聖É$ PSP蹥A9WBPhh-Ë PPV PSPS &vVjhS41򮋅%9t Qj hVډ1ыt fBf؃;w RSh*w,<щ1RغRhV膤NR؃ )кP׉1Rغų RhñV6 1򮋅PSэt h^V1эt BtWPhбVȣv؋K%9GffPW} Ph۱Vc1уK uA9Btt)VPhPDžDž~t"SAPh+P赢A9QGPhGPUA9w\RFffPhdPK!PPhh֒h{5 h=e[^_]ÐUWVS U ҋ}tGPGPPhG/EtGPGPPhSGPGPPh`x_G G OG G 4 vfG fW RPVG PG Pt 11PPhe[^_]ÐUWVSE ]EC}P6{ PP S({ZYPhl跟% 9Ǎw 4fGfEfGfEfGfSuufGfPGPPЃ Ph|hPh1m } }t%%9QjjV*MfUt!%9wtPjjVM>t %9wOWjjVKvuh蘞vm} _uu Mut E Ee[^_]鲝e[^_]UVS] CPys$ SyPVyy PF %Ph  Fff%=uFE Ee[^]ȝe[^]ÐUVS] CPys$ SxPVx PF %Ph@v Fff%=uFE Ee[^]@e[^]ÐUWVS]Cu} Px PQ Ssx[ZPhɷ%9$ h˜Nt FPx[ZPh訜Wh FPwZYPhsWh FPwY[Phv FPw[ZPhζo hܶw WhMWVF hZYWVA.WV"WVPh貛<tPh蕛%)9w{%1JxvÃJytff Ӎuft=fFfE Ee[^_] E Ee[^_]Qe[^_]UWVSE EpV}Uuh迚_tWh 裚}v u9]vUBPh1{9s89]u?E Pu PVhOA9$r9]?tE EAe[^_] UWVS } ]zvsujhEЙPvC %9s9v hU觙'DD* tPvthvv h[#GPh h`eVheXVhmLVh{ʘ VShĽ1QVSh!RVShPVPh舘)e[^_]ÍvUMST1ۅxvÃJyvw؉؋$ÍvUWVS EljEG;%U vEUe[^_]wU Ee[^_]їEfGf9s)Ph`街+ufGfEG HUa:v$0vQuVSURuVSaeuS0uvPuVS5b GPxr PSG PjrZYPhY[Vh)RuVS=PuVS:QuVS%t* GP r PPG PqZYPhɷ苖VS^ %Ee[^_]Z%t* GPq PPG PqZYPhŷ'VS%uSEӷe[^_]v GPPq PSG PBqZYPhѕ VG Ph辕E?tvEt* GPq PSG PpZYPh肕 E juPE%PVUfBfPhB E@t h&ExtGPh UzwGPh% h͔ExvVGPSh"諔(E?u#QUfBfPSh+(U:;%w5 ut#RUfB fPSh3<(mt PuShC[^uGP he[^_]ÉUVS]%S9‹u PfCfPCPCffPZYPhO褓 fCfPC PCffPYZYPhXp%S9w"fCfPFPCPS`e[^]Ðu E_e[^]'vUU BPBPBPBPBPPuh@h  ÐUSRE] MfPf-Qwe$M Ei]饒]M ]U]M ]M Eu]qM E]]‰ME E]CvUWVS %]9Ë} iff t)t t~Hu h v hˑ %s9ffPh蕑_XC2PVmZY5 j'Ju hŸ hҸSE%s6H9w{ffPhYXC2PCPXZVC2ffPY^PhE@@}6u0E Ee[^_]麐} E_e[^_]颐e[^_]UWVS %]9Ëu fftt{E E e[^_]I h;%S9fCfPfCfPffPh  h׏1tn%S9wEfCfPfCfPffPh 荏G1uu E_e[^_]be[^_]UWVS EuEE E}]uJ ha)% SkE<$kE Exe[^_]U=t/=3v=tU= hn裎5%e SUk PQWJk_ZPhwq< h_5%u$ Sk PSW kZYPhw1EUE Ue[^_] h% Sj PQWj_Z}v hύ5% Sj PSWvjZYPhw蝍kvUPh脍%u$ S;j PSW0jZYPhwWuhDvVue[^_]ÐUWVS }u GE_u5%u@ h>E9uEv%uQVuhѹ}wJ%t h诌+vuh`蔌Ph而G鐊Cƒt+ t+vu# h% h hPhC'CECE%UtD REPCPuW t( EPEPCPCPhϋN;tPh貋1C {;=% RkY^Ph˰aC8zB|8;=%;}wOzu CPg^Zv QkkY[Phz EE)}|8;}v h݊\;=%P Rk^ZPh˰越EE)}dVh%蚊%9)PW h-_Ph:J%;}M%)H}~GmG;])]9rq=uuVPhM6PhU躉KxPh裉FKy hd菉;}s U\e[^_]UUMuBAu1]ÐBUWVS u} EgÀt%5 jMXZ5 j-ىӡ DP@u5 j^贉@5 P蜉t9sFuEEHe![^_]ÍvUU%M9Uw~PR3EtjE;%w_5 j.&ZY5%uEt5M; %w*5 j@YX5%uEu5 hT1UVS]C;%r5 h* C%RPjhqy PCuPh芇ƒ t  uƒ҉UMB; %EhBPBhE%U9:PuE M; %5 j.艇[^5%uUBEE;%BPBhEx%U9Puƒ҉UM; %PBh<E#E;%YEPh<U;%F. u9E&UH ;%MCt fP fA f@ fQ ƒPh<脅M; % uEUH;%MCt PA v@Q Rjh`vPhU%M9Uw0PREu/5 h5 he[^]ÉUSQ];%r E E]ԃtD|ZE E]Ovk?j|: E E]銃jh]]]ÍvUWVS]u} w hӻ܃_XvQRVEP܃E؃fuWVf=u&}u uuCPGPFP"f=uw}uqw hڻVZYSV轍1%t EPaZYPh"fEfSWVPiEكU9uL%t RbZYPha RwbPu_ PPus_ZYPh2 %t2 R=b PPE%P'bZYPhfM R b$ u_PE%Pa PPu^ZYPh UڈЃ<Q%PhhsUڊEك RtC Pt Ft?PPQh褁Eڃ=>PFPFPh hvfEffEڊMڊUوȃ ҃Rt ҰCvPt Ft?t'PfEf fR4h$!vfUPf fPRh1Wh%觀t SVve[^_]ÉUWVS EE%ҋ} uDuUWFffBtýRffPCP[ PPC Pt[Y[PhEVRWFffBtýRffP CP/[PhPC P[ZYPha uVx}E ue[^_] e[^_]UVES%PK9ȋu wABff9s/ B9w Bff9s 9ډv1[^]ÍvUSQEX ;%w P1]ÐUWVS %]B9w3ffF9v115 j"l jVWo^_5 j"Q؍e[^_]USuUÃu1]Ð5 j ]]MUWVS %ҋ] u}Du6 S GPbYPffPPG PFYZYPh|9Sh GP'YPffPPG P YZYPh} WV9VffM$PEe[^_]U}Ee[^_]A} hv h#}_X h}ZYSVà S|v hƼ|_X hм|ZYSVFà SÃ% 9ffCffUE Eּe[^_]W|v hG|_XSVÃ1 SÃ%9  ffPCffPCffPC ffPh{ h{ZYSV.à S[v h {{_XSVÃe S'v hG{ZYSVÃ1 SÃ5 hchz$v hz_XSVjà SÃ5 hc z$0ov h#zZYSVÃy SÃc5 hy$`v h,3z_XSVà Sv h3yZYSV~à Slv h:y_XSVJà SÃ%9ffCffUE ECe[^_][yv hRKyZYSVÃt9 S t)FvffU EZe[^_]yvDu5 hcDxe[^_]ÐU0jEPjEPEPUREbE t5 hܾ.5 h5 h5 hm%VH9FPhm%VH9[FPhmm^;%7GPh Im %0%95 hul$ %^95 hDl$%^ 95 h!lFt/ t>tG?tf h'vRjSh`Jm_Xd5 h`kdv SGE E0e[^_]*l SGE E>e[^_]l F P\GY[Phk%^95 j@l$%~95 hLj<$%^ 9wV5 hSjXZSWJ%^(9w(5 hYj] }e[^_] E E_e[^_]ije[^_]UEfff@fP $]EX}ME mM]mQEPRhgjÐUSEff@ff1RP,$XـEZu ]E ]E}]E m]}mSEPQhoj]ÐUWVSU M2ffff)ƋBff‹Iff~1)9v2N/y)9ʿvF9v1) ˿)1RP,$XـEZu ]E ]E}ME mM}mEt5 j- 5 j+iWSVhwie[^_]U%Eҋu8t tv h h PhhÐUWVSU BZ }REYU:%҉=%%wt PSVWeSV0 %tEPVr5 j he[^_]ÐUWVS E}EGu ]$ SCCE Ee[^_]g VCE$CE Ee[^_]gv SBE4$BE E e[^_]ggv VBE$BE Ee[^_]7gv SBE4$BE E'e[^_]gv S_BE4$TBE E7e[^_]fv5 j gE} Ee[^_]fUWVSY[Ph^b9i%9p S=^ZPh˰b9r2vVC9: R=ZYPhsTb %VA9 9 %A9ffV%PRha9rVC9 R1=ZYPhsa %VA9y9V %A9Yff%P%P1@PhVa %SA9st R<^ZPh"a %SA9Kt R_<^ZPh` 9Dv9 v %^A9fft t+v S;Y[Ph) S;[ZPhffRhS`9r5 h_15 h}_e[^_]UWVS }G$Е%%W 9H HwvtPsPh_/u܃ G ffPGPfGfPQGP:^ZPh^_ %O$B9_$t Q:^ZPh*_%O(B9_(t Qg:ZYPh^% h_,^;] %9x S:^_Ph˰^;] rK%WH9?H HwvtQsPhV^/uܡ%WH9± Gtj h^/GtPh!]/GtPh%]%W9GffPh*]%T_  h] St%%_;]  v% 9 hH3]h0CPCPffP$ ];] r5%%W9w_ffKtu VsulfFfKƃuPv%tC_ hw\ StvGPhAJ\1ve[^_]ÍvUWVSEuE} uPs7 PQE Pb7[ZPh[%VH9QFPhLhXMWSPhS[ ;t %VA9WfVf9tf‰E Ee[^_]h[VA9<7F]9C t R6[ZPh6[ %VA9Nt Rs6[ZPhc hlZ %tv]%9fVftOHu, hvZ jjS*K$Z!f‰E E~e[^_]wZvUtE Ee[^_]SZvWV6t E Ee[^_]Ye[^_]UE;%@wv$Pv hk h_ hS hG h ; h/ h# h h! PhzYÐUWVSE xX uPJw h'DYu%7҉5%%t2 fFfPFPS1>HOPh.X SV%tGPV=c5 j Ye[^_]ÍvUWVS } fMfftNfPhAyX_wffPh\XX9rރ h%I GP3ZYPh˰ GP|3[^PhN XOt GPY3^ZPhW_ t G P63ZYPhSWfGftfPhXW hWGffE E=e[^_]mWUWVS E %] )9ˉvʉփHEB$0Shb̉S9t WSQhn vQhV1]9ƒxvSUBPytx hfShzVZYE5%PJF_X5 hU3Sh!ShSh VSRhVUB}PhUe[^_]ÉUEGUWVS } E]@ u8ht5 hT h;TEe EmEUEeP UP %fEUfBtPh4UCO}EE3%tPhTeEECOyuDžu7y3ht5 h5 hTeEfEUfBOECu4=ht5 h5 hS5%UtPh-TEECO8‹9sh ht5 hIS]RVWh!Kv%tPhSU ЋUCOENŋU9s)5huQPWh1ySvE8}v9ht5 hRvEPhB}v>ht5 hfR}WEPUtPhL[vuvM;L|R5ht5 h R$vQDtUPhZREt H]t,NEX@ SH4Dhzt t!wvt[tFhUB ZvE@ 1;PE  ‰CIvUB Z2E@ @UB ZE@UH4hhtx@;E@ 1ҋUB ZCIEPUB ZE@UH4hqxvtt3=tE@ XH4hHvUB ZAE@ X5UB ZPE@MH4DhPEEEe[^_]UWVSUBEB #.tm HpY3v = vۍ{~ EOUPhOMA@|1߹I)M߹UуL M5 M1NEn5%EE]uSvNEt=vEX1Iދ}98LE UJuƋEM.gfffvMU%E9XU%u | |Et)EE)A9tA ɣ|u1Ʌt,}1uPHN|@|,EEu)ƒRuP NEE))U |tvA9EtA ɣ|u1Ʌt+1MɸuPM|@|UuuPMMEH!EEEEMwrha@M~vuha(MfvۺEu{~" 1fQ`FtOҋut55 j"M^E_Pu<Y[5 j"Mۍ{U܃PuPLFOEv2hYLtjh@L۲[{~%PMPPhLEO.ۃ5 j]L@VSR`4hK%5 h5 hKe[^_]ÉUWVS@}WuVEu EÃ}t^5 hJ<$5 hJ_5 hJ^uv9s)Vh Ku؅}Eb]tE9Eu5 h$2JQEPVWEÃ!}MR)uĉuȋuV}̋}WÃ}3EtE9Eu u)߀}v]u5 hIQEPVWEHÃ}w%}tJ5 hXIZus)Et$E9Eu}t5 h$I}tE9Eu EP*uEЅ}e[^_]ÉUWVSP]S}WEu Eƃ}t5 h$vu )VSWu Tƃ}t5 h1}Ew?E܅t;w v PhD]SIPhKH@E܅t<w  PhD]SIPh˰HE܉EQ]S)u Wu ƃ}t#5 h`G$v}wE܅tPhrE܅t9UuPhGCvPhGE܉E'vEt5 hGEu)Wu u EPe[^_]ÉUWVSD5 } j KH ]SWuƃ}t5 hv SXZ5 uj G S)Wu>ƃh}t5 h% So S)uWuƃ'}t5 hvE܃Ew ( uh]SGPh˰tF ]S)uWuƃ}t5 hm}tE܅tPh uh F5 uj F ]S)Wuƃx>}t5 h*E$F S;j)Wuuje[^_]ÐUWVS<}u >%9hvh)5 j (F EPVWEkÃ}t5 h'DZv9s)Vh3EPuċuV}WÃ?}t5 hI*D^UvE܅tPhXD)SuVWÃ}t"5 hiCYuRjhuuDtPuuh|6vE)E uUtEu E Puhe>MtuhJ>EPh5>E tEPh>m]5 }j >E%H91GUEv'9GME9HEM} ECU$И hS=EM9M%9ffv hv hv hfPfD>fPhH<;u|EZuhv hPhF9;u|ՋE})E@}Ev@EU9UtRh9EE,,5 h5 h8}t5 j>,:e[^_]ÐUWVSEEu h`29%9;ffRVh]h`*YXSh˰8;t!F$p5 h!8XZ_5%S(^_5 j"v%W9UfBfE Efe[^_]e8%W9wqQUfBfPhph)^ZPh)8Y[5%GP'XZ5 j"8t8u Ee[^_]7 E Ee[^_])7e[^_]USPE`Mt. PRfAfPh7ff@ff բuRPPfAfPh-7 tPh 7?t?] E]6]ÍvUWVS]} MffCffEfAfEEHEEu%։Uсe?@Eܿ0֋EUуeEEOuPբuPMu UҸtjPVuuh5% uh5Mt)Ct9v h5Lv)Džҍy׋Ut@9vEe[^_]u5uCPhZ5e[^_]ÍvUWVS }1;} 6UfBfEfffƒ= = =t"=i= h4[9Etuh4%t"UBffPhn4u;u `UBff1RP,$XZGff1RP,$XZ GffPG ffPGffP$h3 v h3[9Etuh3=%UBffPhw3uh`3 %tRUBff.uh%03%t"UBffPh310 h2E vPuPh-21ۃ~Sh;2KF;E w=%tffPh2Fff1RP,$XZ Fff1RP,$XZ \$$F ffPFffPFff%Ph@2 KFEEe[^_]UWVS,EEE EEE}%}9ljEvNjMEMEE9MvEXe[^_]1}wMM E_e[^_]m1mEf0ffXff@ffE֡%!H$ P$E Pr PPv PSE PQ ZYPhq0EE EMME e[^_] P($E P PP PPE P ^_Phqp0EMM E e[^_] UBffuEMEM Ue[^_]EMEM Ue[^_]} Pl$E PF PPJ PSE P% ZYPhq/EEEMM E e[^_] P$E P PP PPE P [^PhqD/ 9}$Wu9Er  %UE؋M 9w\AfffuuEEEE Me[^_]鐰fu!HuEEEE Me[^_]vU܋E؃H9ME܀x-@v5?v+-8v!v8v wP%t5 hv-EM܉E Me[^_]gffOE' F;uJ hD'1e[^_]ÍvUWVSuhG~';=%^C ffPCffPCffPS PPVZYPhQ/'% t'VC ffPCffPWV1e[^_]ÉUVS ]hfs&;5%wz C ffPCffPCffPPSZYPhX& % t'RC ffPCffPV1e[^]ÍvUVS]u C ;%{ t hբ&C $pEoe[^]%VC PNVC P>VC P .VC PVC P{VC Px 2C E Exe[^]g%vE>e[^]R%e[^]ÐUWVSuffE$$1ҿ UE0Kt!)KA0҈tKB0MEK.C[^_]ÉUjh $USQE%@ $ ҉Mt ʉ$9@$@u$Ex %$ۉBU#$;$ %Ѕ B h $hpmj\!$% jjEP@"$$tC 3  %$ɉBtj.r t$@ u$$B]ÍvUWVSFN FV F ‰1%  t$v9uC9uC9t9[Cu߃ffKf{jjH#Cu hCuvUt$ EȍUɊȃ$ FB:Bt $ Bȃ$ FBOy EPCe[^_]ÍvUVSu։%@  t9uCkv[Ku Cff $ EfEfEE EEPCe[^]ÐUWVS,uVV FV1%**t9 uC9t4[ { u fSjj!C u hCuvUt$ E؍Uيȃ$ FB:Bt $ Bȃ$ FBOy EPCe[^_]ÍvUWVSuЍR* * t9uCgv[KuCU؉CEsap E1T $ BB EP/Ce[^_]UWVSFYÅ7e[^_]ÉUWVS ɸ t]1fDf%@ ҍ t [Cu7CfD7f C u [^_]ÍvUWVS, 1EEE fDffEEUUڍ EU܍1%**t9 uC9t4[ C u fSjjC u h 6bCG۸ Me[^_]ÐUWVSDhhE>FN FV F ‰1%  t$v9uC9uC9t9[Cu߃ffKf{jjCu h FPp C u7ƃ> u@ ҿ8 7GO GW G ‰1%  t$v9uC9uC9t9[Cu߃ffKfsjjCu h1 suGC OMe[^_]ÐUWVS T tOT 1P @* * t [Ku7CP 7҉Cu [^_]ÉUEUM %t $$ %u?"QvÉUU%@j VSj t9t?[Su36C%t V P v VSPCCe[^]ÍvU u6j j@ @? u hv H  P  ÐUWVS U E8X~GWh1?9 sCPCPPhF 9|_J~519}Uv sCPCPPhF 9|'19} VSPFd9|e[^_]ÉU1]ÐUWVSMu1ɉ;uh{ub{u{Vt~u~ u~ u~u~u~~u*~u$~u~ug~ u` YvV u ~ tCu%~ u~uӀ~ù~uǀ~ t뺃 V71҅ $CU CBBCSC C ‹MUECSCC‹M QCCC‰%QC S CC‹EE7U)CM CAAC S C C‹E}UCS‹M S‰QCSCC‰QCSC C ‹EubUT]IM;vCU CBCSCC‹M QCSC C ‹EMUSM ?QCSCCSCC‰QCSC C ‹EU:U,M ACACSCC‹EEUEEEE}عfU؋E܋M BUEBAACSCC‹E}tCUuPMBCS‹E S‹M QCSCC‰QCSC C ‹E]UM ACSC‰CSCC‰QCSC C ‹EMtNUCvEM UAAt UEt Me[^_]UVS1ɋ]5 vDF@t <t1 B ~ڸ[^]ÐUWVS u} EgÀt%5 jMXZ5 j-ӡ DP@u5 j^@5 Ppt9sFuEEe[^_]UWVS u} EjFÀt%5 jMXZ5 j- ӡ DP@u5 j^@5 PMt;usOuEEe[^_]ÐUVSM~h%QӃ <qљRѸ4 șų) ؙ V)Qh` vySq1hDe[^]ÉUSRUBM ]tv9t%Buu'PSQh % %]ÉUWSQ5%hb]5  E PS5  ;t(1р| t5 j a  jUWSW5%h]5 u E PS5 R ;t(1р| t5 j e[_]ÍvUWVS u;1҅u1k1х u R ǃu h$v҉tvBAuA uAe[^_]ÍvUWVS u1; v@ v  5   u h65V5 u )  e[^_]ÉUWVStj}WP ƃyO ^07 PWhFSEPVj y  Y0 PWhXE @P7 uSV y! Z0 PWhjRU9t RPWhv<e[^_]ÉUWVSXj] $E } $A+E)‹A+E@Aƒ+UuQ+Uԍ)eÉ[^_]ÐUS  tv'ЋuX[]U]ÍUSR[v ]@(#) Copyright (c) 1988, 1989, 1990, 1991, 1992, 1993, 1994, 1995, 1996 The Regents of the University of California. All rights reserved. @(#) $Header: tcpdump.c,v 1.118 96/12/10 23:22:27 leres Exp $ (LBL)̕pܕ,8DT@(#) $Header: print-arp.c,v 1.41 96/10/27 14:54:50 leres Exp $ (LBL)@(#) $Header: print-atalk.c,v 1.45 96/12/10 23:24:07 leres Exp $ (LBL)@(#) $Header: print-atm.c,v 1.8 96/09/26 23:36:41 leres Exp $ (LBL)@(#) $Header: print-bootp.c,v 1.43 96/09/26 23:36:42 leres Exp $ (LBL)ȶȶȶȶȶȶȶ ȶȶ ȶȶȶȶȶȶ@(#) $Header: print-decnet.c,v 1.24 96/11/05 13:30:38 leres Exp $ (LBL)0@@@4@@̽@|@(#) $Header: print-domain.c,v 1.37 96/12/10 23:21:06 leres Exp $ (LBL)@(#) $Header: print-dvmrp.c,v 1.13 96/12/10 23:16:30 leres Exp $ (LBL)|Xt@(#) $Header: print-egp.c,v 1.23 96/11/05 13:30:35 leres Exp $ (LBL)p$h@(#) $Header: print-ether.c,v 1.43 96/09/26 23:36:43 leres Exp $ (LBL)@(#) $Header: print-fddi.c,v 1.33 96/12/10 23:20:49 leres Exp $ (LBL)@(#) $Header: print-gre.c,v 1.4 96/12/10 23:28:23 leres Exp $@(#) $Header: print-icmp.c,v 1.38 96/09/26 23:36:44 leres Exp $ (LBL)h@(#) $Header: print-igrp.c,v 1.6 96/12/10 23:27:35 leres Exp $ (LBL)@(#) $Header: print-ip.c,v 1.62 96/12/10 23:20:31 leres Exp $ (LBL)H(XXXXXXX@LT((((4((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((D((((((((d@(#) $Header: print-ipx.c,v 1.19 96/12/10 23:23:52 leres Exp $h|@(#) $Header: print-isoclns.c,v 1.14 96/12/10 23:26:56 leres Exp $ (LBL)@(#) $Header: print-krb.c,v 1.8 96/12/10 23:17:39 leres Exp $@(#) $Header: print-llc.c,v 1.22 96/12/10 23:23:37 leres Exp $@(#) $Header: print-nfs.c,v 1.63 96/12/10 23:18:07 leres Exp $ (LBL)8Ld(H@( X   " 0!d!!!"4"h"""@(#) $Header: print-ntp.c,v 1.25 96/11/05 13:30:37 leres Exp $ (LBL)##$$$$4$D$T$@(#) $Header: print-null.c,v 1.22 96/12/10 23:18:58 leres Exp $ (LBL)@(#) $Header: print-ospf.c,v 1.23 96/12/10 23:15:46 leres Exp $ (LBL)8*\****+8- %d at-lap#%d %daarp who-has %s tell %sreply %s is-at %sprobe %s tell %s at-%s %d atp-req%s %d [len=%d] [EOM] [STS] [EOM,STS] atp-resp%s%d:%d (%d) [XO] [XO,STS] atp-rel %d%cXO%cEOM%cSTS atp-0x%x %d (%d)%c%d<0-%d><0> truncated-nbp %d nbp-lkup %d: nbp-brRq %d: [ntup=%d] [enum=%d] [addr=%s.%d] nbp-reply %d: nbp-0x%x %d (%d) [addr=%s]/etc/atalk.names%d.%d.%d %s%s.%dzipnislen %d op %d htype %d ptype %#x halen %d palen %d[|atm]%04x%04x %04x%04x %02x %02x %02x %02x-%02x-%02x %04x: (request) (reply) bootp-#%d htype-#%d hlen:%d hops:%d xid:0x%x secs:%d C:%s Y:%s S:%s G:%s ether %s sname " file "vend-#0x%xaEPaRPiSSaDNaDP ENDsBSaHNiRLiIMiLPRiCSiLOGiNSiIENiTSiDGlTZiSM PAD vend-rfc1048?T%d %s:%s vend-cmu F:0x%xSM*NS1NS2IEN1IEN2TS1TS2[|decnet][pad:%d] future-version-decnet%s > %s %d RQR RTS IE %d hops init verification src %s fcnval %otest src %s data %olev-1-routing src %s lev-2-routing router-hello endnode-hello unknown control messagereserved-ntype? l2rout l1rout endnode verif blo {ids %d-%d cost %d hops %d} nomcast data %d>%d onak %d oack %d seg %d intr nakdat %d ackdat %d link-service %d>%d dat seg count %d donotsend-data reserved-fcmod? %xintr req count %d reserved-fcval-int? %xreserved-subtype? %x %d > %ddata-ack %d>%d ils-ack %d>%d conn-ack %dreserved-acktype? %x %d > %dretrans-conn-initiate seg msg crypt ver 3.2 ver 3.1 ver 4.0 ver 4.1 segsize %d optlen %d disconn-initiate %d>%d disconn-confirm %d>%d reserved-ctltype? %x %d > %dreserved-type? %x %d > %dbad image data in connectdisconnect completeno link terminatenode unreachableno response from objectbad ACCOUNT informationinsufficient local resourceslocal node shutting downinvalid node name formatuser abortthird party abortprotocol error discoveredobject too busyinvalid object name formatunrecognized objectnode is shutting downunrecognized node nameinsufficient resourcesobject rejected connectreason-%ddnnum_string: mallocunknown message flags under masksrc %sblksize %d vers %d eco %d ueco %d hello %dvers %d eco %d ueco %d src %s blksize %d pri %d hello %dvers %d eco %d ueco %d src %s blksize %d rtr %s hello %d data %o{areas %d-%d cost %d hops %d} cryptographic service mismatchinvalid access control informationinsufficient remote user resources zoneRef zoneInit updateMA updateM updateDA updateD updataA op8 op7 op6 op5 notify op3 stat inv_q NoChange Resp14 Resp13 Resp12 Resp11 Resp10 Resp9 Resp8 Resp7 Resp6 Refused NotImp NXDomain ServFail FormErrANYMAILAMAILBAXFRUNSPECAUNSPECLOC AAAAGPOSPXSIGNSAP_PTRNSAPRTISDNX25AFSDBTXTMXMINFOHINFOWKSNULLMRMGMBSOACNAMEMFMDHSCHAOS)INType%d(Class %d) %.*s| %d%s%s%s%s%s [%dq] q: %d/%d/%d+ %d%s%s [b2&3=0x%x] [%da] [%dn] [%dau] Probe Report Ask-neighbors(old) Neighbors(old) Ask-neighbors2 Neighbors2 Prune Graft Graft-ACK [type %d] [|] Mask %s [Truncated Report] %s metric %d [|} genid %u neighbor %s [%s -> %s, (%d/%d)] (v %d.%d): [%s -> %s (%d/%d/tunnel/srcrt/querier/disabled/down src %s grp %s timer %dcease_ackceaserefuseconfirmprotocol_violationparameter_violationgoing_downadministratively_prohibitedinsufficient_resourcespassive_modeactive_modeunspecifiedi-h-uhelloindeterminateunsupported_versionno_responseexcessive_polling_ratereachability_info_unavailablebad_EGP_data_field_formatbad_EGP_header_formatint%sd%d:, %s > %s: egp: as:%d seq:%d acquire [status %d] hello:%d poll:%d[code %d] state:%s[reach code %d] poll net:%s update unsolicited %s int %d ext %d error [reason %d]%s %s %s %d: [|ether](LLC %s) et1 void nrt info nsa beacon claim mac%1x smt%1x imp_async%1x imp_sync%1x %02x %02x %s %s %d: [|fddi]gre-proto-0x%04X[|gre]address mask requestinformation replyinformation requesttime stamp replytime stamp requestrouter solicitationecho requestsource quenchecho replyhost %s unreachable - unknownnet %s unreachable - unknownhost %s unreachablenet %s unreachableredirect-tos %s to net %sredirect %s to host %sredirect %s to net %s%s protocol %d unreachable%s tcp port %s unreachable%s udp port %s unreachable%s unreachable - need to frag#%d %%s unreachableredirect-#%d %%s to net %%srouter advertisement lifetime %u:%02u%u:%02u:%02u [size %d] {%s %u}time exceeded in-transitip reassembly time exceededtime exceeded-#%dparameter problem - code %dparameter problem - octet %daddress mask is 0x%08xicmp: %s[|icmp]host %s unreachable - precedence cutoffhost %s unreachable - host precedence violationhost %s unreachable - admin prohibited filterhost %s unreachable - tos prohibitednet %s unreachable - tos prohibitedhost %s unreachable - admin prohibitednet %s unreachable - admin prohibited%s unreachable - source host isolated%s unreachable - source route failed%s protocol %d port %d unreachable%s unreachable - need to frag (mtu %d) *.%d.%d.%d X%d.%d.%d.0 %d.%d.%d.0%s > %s: igrp: op-#%d[extra bytes %d][|igrp] d=%d b=%d r=%d l=%d M=%d mtu=%d in %d hops %s V%d edit=%d AS=%d (%d/%d/%d)mtrace %d: %s to %s reply-to %smresp %d: %s to %s reply-to %struncated-ip - %d bytes missing! with-ttl %digmp query [gaddr %s] [len %d]igmp report %sigmp nreport %sigmp leave %sigmp dvmrpigmp pimigmp-%d [v%d] bad igmp cksum %x![|igmp] %s{ [bad length %d] [bad ptr %d]#%s}[|ip op len %d][|ip] EOL NOP TS{%d} SECURITY{%d} RR{%d}=SSRRLSRR IPOPT-%d{%d}truncated-ip %d%s > %s: nd %d (encap)gre %s > %s: (gre encap) ip-proto-%d %d (frag %d:%d@%d%s) (DF) [tos 0x%x] [ttl %d] (%sttl %d%sid %d%sbad cksum %x!%soptlen=%d%s.%x > %s.%x:[|ipx %d] ipx-ncp %d ipx-netbios %d ipx-diags %d ipx-#%x %dipx-sap-reqipx-sap-nearest-req %x 'ipx-sap-respipx-sap-nearest-resp' addr %sipx-sap-?%xipx-rip-req %u/%d.%dipx-rip-respipx-rip-?%x%x.%02x:%02x:%02x:%02x:%02x:%02x[|iso-clns] iso-clns %s > %siso-esisiso-isis len=%d iso-nullnsiso-clns %02x bad pkt! no header at all! LI(%d) > PDU size (%d)!%02X redirect esh ish unsupported version %d [bad li] len=%d bad opts/li opt (%d) too long tmo=%d %d:< too short for esis header %d: bad cksum (got %02x%02x want %02x%02x)DIEAPPL_ERRSAFEPRIVATEERR_REPLYAPPL_REQUEST_MUTUALAPPL_REQUESTKDC_REPLYKDC_REQUESTNULL_KEYPRINCIPAL_NOT_UNIQUEPRINCIPAL_UNKNOWNBYTE_ORDERSERV_MAST_KEY_VERNAME_MAST_KEY_VERPKT_VERAUTH_EXPSERVICE_EXPNAME_EXP %s %s: %dmin v%d (unknown) v%d v5frmrsabmedmdiscuaxidtestui[|llc][|llc-snap]snap %s %s > %s %s %s > %s %s %s/%c: %02x %02x03rnrrej%s (r=%d,%c)I (s=%d,r=%d,%c)ok%s.nfs > %s.%x: reply %s %d%s.%x > %s.%x: reply %s %d%s.%x > %s.nfs: %d%s.%x > %s.%x: %d nop null getattr setattr lookup readlink read %u bytes @ %u write %u (%u) bytes @ %u (%u) create remove rename link symlink mkdir rmdir readdir %u bytes @ %d statfs proc-%u [|nfs] fh %s/%u fh %u,%u/%u PROG_UNAVAIL PROG_MISMATCH PROC_UNAVAIL GARBAGE_ARGS SYSTEM_ERR ar_stat %d ERROR: %sLNKCHRBLKDIRREGNONunk-ft %d %s %o ids %u/%u sz %u %u.%06u offset %x size %u eofnlink %u rdev %x fsid %x nodeid %x a/m/ctime tsize %u bsize %u blocks %u bfree %u bavail %u +1s -1s unspec sym_act sym_pas client server bcast res1 res2 strat %d poll %d prec %d dist disp ref (unspec)%s INFO_QUERY%s INFO_REPLY orig rec xmt [|ntp]%d.%06d%u.%09d%d.%09d>.AA=eAip: ns: AF %d: MCW2W1ls_ackls_updls_reqddumd S %X age %c%s rtr %s net dr %s if %s sum %s abr %s abr %s rtr %s ase %s asbr %s group %s rtr %s {ls_type %d virt nbrid %s if %s net %s mask %s ??RouterLinksType %d?? } tos 0 metric %d mask %s rtrs type %d tos %d metric %d forward %s tag %s rtr rtrid %s net dr %s ??VertexType %u?? bdr %s nbrs%cI%cM%cMS S %XLinkStateType %dv2 type %dtype%d OSPFv%d-%s %d: area %s backbone auth " ??authtype-%d?? ospf [version %d] mask %s int %d pri %d dead %u Query Register Register-Stop Join/Prune RP-reachable Assert Mode[|ppp]%c %4d %02x %04x: [family %d: {%s->%s tag %04x rip-req %d rip-resp %d[%d]: rip-resp %d:[|rip] rip-traceon %d: "" rip-traceoff %d rip-poll %d rip-pollentry %d rip-#%d %d [vers %d]not configured for slipSetSequenceU-15U-14U-13U-12U-11U-10U-9U-8ObjectDesObjIDNullStringBitstringIntegerBooleanU-0OpaqueTimeTicksGaugeCounterIpAddressTrapSetRequestGetResponseGetNextRequestGetRequestP-0genErrreadOnlybadValuenoSuchNametooBignoErrorenterpriseSpecificegpNeighborLossauthenticationFailurelinkUplinkDownwarmStartcoldStartConstructedPrimitiveproteonibmunixacctwgcaymannysernetcisconschpepilogueutennesseebbnxylogicsunisyscanstarwellfleettrwmitspartacusexcelanspidernsfnetsytekintergraphinterlanvitalinkulananswcsantacruzoperationxyplexcraybellnorthernresearchdectouchnetworkresearchcorpbaylornmfeccllnlsrisun3comcmcsynopticscheyenneprimemcncchipcomopticaldatasystemsgatedcabletronapollodesktalksystemsssdscastlerockmipstgvsilicongraphicsubcmeritfibercomapplegandalfdartmouthdavidsystemsreutercornelltmaclocusnasaretixboeingattungermannbassdigitalanalysishplanmannetlabsiclauspexlannetncdraycompirellifocomdatabilitynetworkappltechnyurndinterconlearningtreewebstercomputerfrontiernokiaallenbradleycernsigmaemergingtechsnmpresearchohiostateultraccurenterprisessnmpInPktssnmpOutPktssnmpInBadVersionssnmpInBadCommunityNamessnmpInBadCommunityUsessnmpInASNParseErrssnmpInBadTypessnmpInTooBigssnmpInNoSuchNamessnmpInBadValuessnmpInReadOnlyssnmpInGenErrssnmpInTotalReqVarssnmpInTotalSetVarssnmpInGetRequestssnmpInGetNextssnmpInSetRequestssnmpInGetResponsessnmpInTrapssnmpOutTooBigssnmpOutNoSuchNamessnmpOutBadValuessnmpOutReadOnlyssnmpOutGenErrssnmpOutGetRequestssnmpOutGetNextssnmpOutSetRequestssnmpOutGetResponsessnmpOutTrapssnmpEnableAuthTrapsegpNeighStateegpNeighAddregpNeighAsegpNeighInMsgsegpNeighInErrsegpNeighOutMsgsegpNeighOutErrsegpNeighInErrMsgsegpNeighOutErrMsgsegpNeighStateUpsegpNeighStateDownsegpNeighIntervalHelloegpNeighIntervalPollegpNeighModeegpNeighEventTriggeregpNeighEntryegpInMsgsegpInErrorsegpOutMsgsegpOutErrorsegpNeighTableegpAsudpLocalAddressudpLocalPortudpEntryudpInDatagramsudpNoPortsudpInErrorsudpOutDatagramsudpTabletcpConnStatetcpConnLocalAddresstcpConnLocalPorttcpConnRemAddresstcpConnRemPorttcpConnEntrytcpRtoAlgorithmtcpRtoMintcpRtoMaxtcpMaxConntcpActiveOpenstcpPassiveOpenstcpAttemptFailstcpEstabResetstcpCurrEstabtcpInSegstcpOutSegstcpRetransSegstcpConnTabletcpInErrstcpOutRstsicmpInMsgsicmpInErrorsicmpInDestUnreachsicmpInTimeExcdsicmpInParmProbsicmpInSrcQuenchsicmpInRedirectsicmpInEchosicmpInEchoRepsicmpInTimestampsicmpInTimestampRepsicmpInAddrMasksicmpInAddrMaskRepsicmpOutMsgsicmpOutErrorsicmpOutDestUnreachsicmpOutTimeExcdsicmpOutParmProbsicmpOutSrcQuenchsicmpOutRedirectsicmpOutEchosicmpOutEchoRepsicmpOutTimestampsicmpOutTimestampRepsicmpOutAddrMasksicmpOutAddrMaskRepsipNetToMediaIfIndexipNetToMediaPhysAddressipNetToMediaNetAddressipNetToMediaTypeipNetToMediaEntryipRouteDestipRouteIfIndexipRouteMetric1ipRouteMetric2ipRouteMetric3ipRouteMetric4ipRouteNextHopipRouteTypeipRouteProtoipRouteAgeipRouteMaskipRouteEntryipAdEntAddripAdEntIfIndexipAdEntNetMaskipAdEntBcastAddripAdEntReasmMaxSizeipAddrEntryipForwardingipDefaultTTLipInReceivesipInHdrErrorsipInAddrErrorsipForwDatagramsipInUnknownProtosipInDiscardsipInDeliversipOutRequestsipOutDiscardsipOutNoRoutesipReasmTimeoutipReasmReqdsipReasmOKsipReasmFailsipFragOKsipFragFailsipFragCreatesipAddrTableipRoutingTableipNetToMediaTableatIfIndexatPhysAddressatNetAddressatEntryatTableifIndexifDescrifTypeifMtuifSpeedifPhysAddressifAdminStatusifOperStatusifLastChangeifInOctetsifInUcastPktsifInNUcastPktsifInDiscardsifInErrorsifInUnknownProtosifOutOctetsifOutUcastPktsifOutNUcastPktsifOutDiscardsifOutErrorsifOutQLenifSpecificifEntryifNumberifTablesysDescrsysObjectIDsysUpTimesysContactsysNamesysLocationsysServicessysteminterfacesicmpudpegptransmissionsnmpmibdirectorymgmtexperimentalprivateinternetdodorgiso+X:+E:+[|snmp][nothing to parse], stdout|%.2x[Xtagfield?][no asnlen][asnlen? %d<%d][len%d %s.sunrpc: %d proc #%u [rpcver %u]truncated-tcp %d%s.%s > %s.%s: tcp_print: calloc [bad hdr length] %u:%u(%d) ack %u win %d urg %dmsseolwscalesackOKsack %u@%uechoreplytimestampccnewccechoopt-%d:[bad opt][|tcp]ERRORDATAWRQRRQENOUSEREEXISTSEBADIDEBADOPENOSPACEEACCESSENOTFOUNDEUNDEFtftp-#%d block %dtftp-err-#%d "(unknown #%d) udp/vt %u %d / %d udp/vat %u c%d %u%s f%d s%drtpv1 udp/%s %d c%d %s%s %d %u !opt !ext 0x%04x [|rtcp] sr [%d] @%.2f %u %up %ub rr sdes %d bye %d type-0x%x %d c%d %ul %us %uj @%.2f+%.2f[|udp] truncated-udp %d%s.%s > %s.%s:kip udp %u wb-id: %u/%s:%u (max %u/%s:%u) %c%s:%u wb-rreq: wb-preq: need %u/%s:%u wb-prep:HOLESKIPREFPSCOMPPSCODESTRCHARELLXFORMDELMLLINERECTdop-1!dop-0! < dop-%d![|wb] > wb-rrep: for %s %s:%u<%u:%u> wb-dop: wb-kill wb-%d! please repair %s %s:%u<%u:%u>lookup_emem: calloclookup_nsap: malloclookup_nsap: calloclookup_protoid: callocsap isonsap_string: mallocBroadcast/etc/ethersglobalprowayx.25/llc2eia-rs511802.1dproway-nmip-sap802.1b-isap802.1b-gsapnewhnamemem: calloc%d %u %u %u %u { 0x%x, %d, %d, 0x%08x }, AuspexOSFIRIX4IRIX5SUNOS3SUNOS4SUNOS5UltrixVMSAIX32HPUX9Unknown%02d:%02d:%02d.%06u %s: WARNING: copy_argv: mallocsavestr: malloccan't open %s: %scan't stat %s: %sread %s: %sshort read %s (%d != %d) D0<8  x)d ~vrKm[|atalk]~95 [|bootp]CMUcSc { w s o kfb^ZVRnXD)  ɦ  !"@${&c'R)@*,+6  ܩөɩ}skb[TMF>6.&ѩ      Ϫ s۪تӪʪƪêgh)"ǯ߬լrfYB&~üĦrϭ@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?H:-  ϯqS`    ` ϰǯ [|kerberos]̺ º ~sjbP>3!  л˻ǻcĻCo ޽ۿؿѿʿÿ [|ospf]skcYRMG=950+&! ~w`VMF0   vjǢ     0@P`p ) 20;@APF `Y!p`"e#z$~%&'()*+, -0.@/P0`1p2345 67 8+90:4;D< H=0N>@W?P]@`eApoB|CDEFGHIJKL M0N@OPP`QpRSTUV˼W X$Y(Z1[>\ N]0W^@]_Pj``oapubcde 0@*P8 `J pZ j x  0#@4PC`Vpfy 0$ @7 PH `[ pq 0@-`8pDTP]j~ 0@P `p* 7 A L [ hr} 0@P` p  ) 9 LXfz 0@P`p(<Tk| 0@P `  p $1=L[l 0@P`p    ( 6 ER]jt 0@Pp #1 > 0K @V Pd `s p 0P%`/p:BNZa@A`lqu  y 0 @P`p`  VLD;4-% [|tftp]+$  a0123456789abcdefj^WMBFN<~2+n$3.3 Ə֏&6FVfvƐ֐&6FVfvƑ֑&6FVfvƒ֒&6FVfvD_ X Ї( e  P@oЌoo*dd9<Hr0,V1V cV$[Lby !"#3%K&a1x234568 9";B=X>n?@ABCDE F$G;HTIiNQRST9UUVmX[^ehl q r5 uP vm y z } & @ ˔t F  #V Y 4u < C F S Z ^ltMyn4 Lb8wbKL#5LwH8KgLUZ^?awb\r5 7!899S:m dinit.c/usr/src/build/40453-i386/BUILD/glibc-2.2.4/csu/gcc2_compiled.int:t(0,1)=r(0,1);-2147483648;2147483647;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,3);-2147483648;2147483647;unsigned int:t(0,4)=r(0,4);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,5);0000000000000;0037777777777;long long int:t(0,6)=@s64;r(0,6);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=@s64;r(0,7);0000000000000;01777777777777777777777;short int:t(0,8)=@s16;r(0,8);-32768;32767;short unsigned int:t(0,9)=@s16;r(0,9);0;65535;signed char:t(0,10)=@s8;r(0,10);-128;127;unsigned char:t(0,11)=@s8;r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);12;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);8;0;complex double:t(0,17)=r(0,17);16;0;complex long double:t(0,18)=r(0,18);24;0;__builtin_va_list:t(0,19)=*(0,20)=(0,20)../include/libc-symbols.h/usr/src/build/40453-i386/BUILD/glibc-2.2.4/build-i386-linux/config.h../sysdeps/gnu/_G_config.h../sysdeps/unix/sysv/linux/bits/types.h../include/features.h../include/sys/cdefs.h../misc/sys/cdefs.h/usr/lib/gcc-lib/i386-redhat-linux/2.96/include/stddef.hsize_t:t(8,1)=(0,4)__u_char:t(4,1)=(0,11)__u_short:t(4,2)=(0,9)__u_int:t(4,3)=(0,4)__u_long:t(4,4)=(0,5)__u_quad_t:t(4,5)=(0,7)__quad_t:t(4,6)=(0,6)__int8_t:t(4,7)=(0,10)__uint8_t:t(4,8)=(0,11)__int16_t:t(4,9)=(0,8)__uint16_t:t(4,10)=(0,9)__int32_t:t(4,11)=(0,1)__uint32_t:t(4,12)=(0,4)__int64_t:t(4,13)=(0,6)__uint64_t:t(4,14)=(0,7)__qaddr_t:t(4,15)=(4,16)=*(4,6)__dev_t:t(4,17)=(4,5)__uid_t:t(4,18)=(4,3)__gid_t:t(4,19)=(4,3)__ino_t:t(4,20)=(4,4)__mode_t:t(4,21)=(4,3)__nlink_t:t(4,22)=(4,3)__off_t:t(4,23)=(0,3)__loff_t:t(4,24)=(4,6)__pid_t:t(4,25)=(0,1)__ssize_t:t(4,26)=(0,1)__rlim_t:t(4,27)=(4,4)__rlim64_t:t(4,28)=(4,5)__id_t:t(4,29)=(4,3)__fsid_t:t(4,30)=(4,31)=s8__val:(4,32)=ar(4,33)=r(4,33);0000000000000;0037777777777;;0;1;(0,1),0,64;;__daddr_t:t(4,34)=(0,1)__caddr_t:t(4,35)=(4,36)=*(0,2)__time_t:t(4,37)=(0,3)__useconds_t:t(4,38)=(0,4)__suseconds_t:t(4,39)=(0,3)__swblk_t:t(4,40)=(0,3)__clock_t:t(4,41)=(0,3)__clockid_t:t(4,42)=(0,1)__timer_t:t(4,43)=(0,1)__key_t:t(4,44)=(0,1)__ipc_pid_t:t(4,45)=(0,9)__blksize_t:t(4,46)=(0,3)__blkcnt_t:t(4,47)=(0,3)__blkcnt64_t:t(4,48)=(4,6)__fsblkcnt_t:t(4,49)=(4,4)__fsblkcnt64_t:t(4,50)=(4,5)__fsfilcnt_t:t(4,51)=(4,4)__fsfilcnt64_t:t(4,52)=(4,5)__ino64_t:t(4,53)=(4,5)__off64_t:t(4,54)=(4,24)__t_scalar_t:t(4,55)=(0,3)__t_uscalar_t:t(4,56)=(0,5)__intptr_t:t(4,57)=(0,1)__socklen_t:t(4,58)=(0,4)../linuxthreads/sysdeps/pthread/bits/pthreadtypes.h../sysdeps/unix/sysv/linux/bits/sched.h__sched_param:T(10,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(9,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(9,2)=(9,3)=*(9,4)=xs_pthread_descr_struct:__pthread_attr_s:T(9,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(10,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(8,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(0,19),224,32;__stacksize:(8,1),256,32;;pthread_attr_t:t(9,6)=(9,5)pthread_cond_t:t(9,7)=(9,8)=s12__c_lock:(9,1),0,64;__c_waiting:(9,2),64,32;;pthread_condattr_t:t(9,9)=(9,10)=s4__dummy:(0,1),0,32;;pthread_key_t:t(9,11)=(0,4)pthread_mutex_t:t(9,12)=(9,13)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(9,2),64,32;__m_kind:(0,1),96,32;__m_lock:(9,1),128,64;;pthread_mutexattr_t:t(9,14)=(9,15)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(9,16)=(0,1)_pthread_rwlock_t:T(9,17)=s32__rw_lock:(9,1),0,64;__rw_readers:(0,1),64,32;__rw_writer:(9,2),96,32;__rw_read_waiting:(9,2),128,32;__rw_write_waiting:(9,2),160,32;__rw_kind:(0,1),192,32;__rw_pshared:(0,1),224,32;;pthread_rwlock_t:t(9,18)=(9,17)pthread_rwlockattr_t:t(9,19)=(9,20)=s8__lockkind:(0,1),0,32;__pshared:(0,1),32,32;;pthread_spinlock_t:t(9,21)=(0,1)pthread_barrier_t:t(9,22)=(9,23)=s20__ba_lock:(9,1),0,64;__ba_required:(0,1),64,32;__ba_present:(0,1),96,32;__ba_waiting:(9,2),128,32;;pthread_barrierattr_t:t(9,24)=(9,25)=s4__pshared:(0,1),0,32;;pthread_t:t(9,26)=(0,5)wchar_t:t(11,1)=(0,3)wint_t:t(11,2)=(0,4)../include/wchar.h../wcsmbs/wchar.h../sysdeps/unix/sysv/linux/i386/bits/wchar.h__mbstate_t:t(13,1)=(13,2)=s8__count:(0,1),0,32;__value:(13,3)=u4__wch:(11,2),0,32;__wchb:(13,4)=ar(4,33);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(3,1)=(3,2)=s12__pos:(4,23),0,32;__state:(13,1),32,64;;_G_fpos64_t:t(3,3)=(3,4)=s16__pos:(4,54),0,64;__state:(13,1),64,64;;../include/gconv.h../iconv/gconv.h :T(17,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(17,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(17,3)=(17,4)=*(17,5)=f(0,1)__gconv_init_fct:t(17,6)=(17,7)=*(17,8)=f(0,1)__gconv_end_fct:t(17,9)=(17,10)=*(17,11)=f(0,20)__gconv_trans_fct:t(17,12)=(17,13)=*(17,14)=f(0,1)__gconv_trans_context_fct:t(17,15)=(17,16)=*(17,17)=f(0,1)__gconv_trans_query_fct:t(17,18)=(17,19)=*(17,20)=f(0,1)__gconv_trans_init_fct:t(17,21)=(17,22)=*(17,23)=f(0,1)__gconv_trans_end_fct:t(17,24)=(17,25)=*(17,26)=f(0,20)__gconv_trans_data:T(17,27)=s20__trans_fct:(17,12),0,32;__trans_context_fct:(17,15),32,32;__trans_end_fct:(17,24),64,32;__data:(0,19),96,32;__next:(17,28)=*(17,27),128,32;;__gconv_step:T(17,29)=s56__shlib_handle:(17,30)=*(17,31)=xs__gconv_loaded_object:,0,32;__modname:(17,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(4,36),96,32;__to_name:(4,36),128,32;__fct:(17,3),160,32;__init_fct:(17,6),192,32;__end_fct:(17,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(0,19),416,32;;__gconv_step_data:T(17,33)=s36__outbuf:(17,34)=*(0,11),0,32;__outbufend:(17,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(17,35)=*(13,1),160,32;__state:(13,1),192,64;__trans:(17,28),256,32;;__gconv_info:T(17,36)=s8__nsteps:(8,1),0,32;__steps:(17,37)=*(17,29),32,32;__data:(17,38)=ar(4,33);0;-1;(17,33),64,0;;__gconv_t:t(17,39)=(17,40)=*(17,36)_G_iconv_t:t(3,5)=(3,6)=u44__cd:(17,36),0,64;__combined:(3,7)=s44__cd:(17,36),0,64;__data:(17,33),64,288;;,0,352;;_G_int16_t:t(3,8)=(0,8)_G_int32_t:t(3,9)=(0,1)_G_uint16_t:t(3,10)=(0,9)_G_uint32_t:t(3,11)=(0,4)_IO_stdin_used:G(0,1)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-97)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-97)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-98)GCC: (GNU) 2.96 20000731 (Red Hat Linux 7.1 2.96-97)01.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.sbss.bss.stab.stabstr.comment.note# 1((\7  ?Go** ToЌ @c  @l PP  uXX{pp @ЇS [4 y y y y z { { { H OpX4E 8((*ЌP X p  Ї           +2  =A O[ q @ P   2       Ї    D#@,8 ; >  EJ P  @G^8g$ l$? z   L (  d  0g 0 4(  d D  Gg\ f(j55 C4C MpU x Hdm[ l d ~ |~    (   @H@@C  $ ^P $p(. 8 B @ GP \5 i yp} p `U U    Ek   G  F  `>   FP!Pp^(- L @E:L KR  D] j` vP 8  M  , ??     I *   >g ^P``  ? H  E(D/(b < Ie R' ZH f8t n? wZ  ! Ld ^ 8 x6 I E D   8#  E` '_ '  ( ! () F.()O 9 * FFH Wh(^X8g j *h }t+i ,0 2  8 D 8 E t9 Et9?  0< `D D< FD<` h A pF& &H 4J ? N  HN$8WOT _ e\p HP D|(V X  FK`0H  `Z E`Z @[ \d  f  DfU lg hr th xi pj 0k  l F_$ pm +$/$9$D%L$ Pu _u} ppv 8 Xw P `$yj    z C { `B { FG   @@_ %       ( ? U j r {  0      `  $ 4 H \   k p P     p   `  " N4 = @O [ n Wx    %    Џc  @  @. 7 @D N a 8 k x  n          L  p# + "L @] t HS ` l Np @  .    P| (6 @HJ\e w3 <] %p0-#4@Y@k8` u  `p, PF * % 02@B@ Ng`ypp0@pP pp$4PBL M%S"a l|p%Ptn HP *"-E0Y kuq %` 0g`"{4 +04BNg%mА}X 0%( p %*3 =I"l@0 PD% &P$.C@Uh z tr    / 7Oe s JP`d2 0D !p0p BW ^0g0}pp@3P@F 5  @`R p"*d 6p/JI[a, m0{R\z[ %P`x) 0AS0h `@* 00P0 >SБ+ir`{ z `  me )8IVh{%@% @ Ȕ T `z P{ 4 HeX pP@P`@ yy .`BU0c0{|}    2( 4F0tXЇ ^@qpp x P`` n)   0 R (:@L V0ip `0l "@ ) 9 @I V pe q   `  ` %   !% ! !yN 0!